SCOPe 2.07: Domain d6jmvb_: 6jmv B:

Lineage for d6jmvb_ (6jmv B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d6jmvb_: 6jmv B: [371893]
   Other proteins in same PDB: d6jmva2
   automated match to d4mf3a_
   complexed with act, cl, gol, na, sym, zn

Details for d6jmvb_

PDB Entry: 6jmv, 1.83 Å

PDB Description: crystal structure of the gluk3 ligand binding domain complex with sym and zinc

PDB Compounds: (B:) Glutamate receptor ionotropic, kainate 3

SCOPe Domain Sequences for d6jmvb_:

Sequence; same for both SEQRES and ATOM records:

>d6jmvb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyg
aqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpids
addlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlta
dyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedkl
himkekwwrgsgc

Timeline for d6jmvb_:

• d6jmvb_ is new in SCOPe 2.07-stable
  
• d6jmvb_ appears in the current release, SCOPe 2.08