Lineage for d6itqd1 (6itq D:6-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742186Species Camelus bactrianus [TaxId:9837] [371849] (6 PDB entries)
  8. 2742191Domain d6itqd1: 6itq D:6-126 [371881]
    Other proteins in same PDB: d6itqa2, d6itqb2, d6itqc2, d6itqd2
    automated match to d4nbxb_
    complexed with hcy, so4

Details for d6itqd1

PDB Entry: 6itq (more details), 1.53 Å

PDB Description: crystal structure of cortisol complexed with its nanobody at ph 10.5
PDB Compounds: (D:) anti-cortisol camelid antibody

SCOPe Domain Sequences for d6itqd1:

Sequence, based on SEQRES records: (download)

>d6itqd1 b.1.1.1 (D:6-126) automated matches {Camelus bactrianus [TaxId: 9837]}
esgggsvqaggslrlscvvsgntgstgywawfrqgpgteregvaatytagsgtsmtyyad
svkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtv
s

Sequence, based on observed residues (ATOM records): (download)

>d6itqd1 b.1.1.1 (D:6-126) automated matches {Camelus bactrianus [TaxId: 9837]}
esgggsvqaggslrlscvvsgntgstgywawfrqgpregvaatytagstsmtyyadsvkg
rftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtvs

SCOPe Domain Coordinates for d6itqd1:

Click to download the PDB-style file with coordinates for d6itqd1.
(The format of our PDB-style files is described here.)

Timeline for d6itqd1: