Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Camelus bactrianus [TaxId:9837] [371849] (6 PDB entries) |
Domain d6itqd1: 6itq D:6-126 [371881] Other proteins in same PDB: d6itqa2, d6itqb2, d6itqc2, d6itqd2 automated match to d4nbxb_ complexed with hcy, so4 |
PDB Entry: 6itq (more details), 1.53 Å
SCOPe Domain Sequences for d6itqd1:
Sequence, based on SEQRES records: (download)
>d6itqd1 b.1.1.1 (D:6-126) automated matches {Camelus bactrianus [TaxId: 9837]} esgggsvqaggslrlscvvsgntgstgywawfrqgpgteregvaatytagsgtsmtyyad svkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtv s
>d6itqd1 b.1.1.1 (D:6-126) automated matches {Camelus bactrianus [TaxId: 9837]} esgggsvqaggslrlscvvsgntgstgywawfrqgpregvaatytagstsmtyyadsvkg rftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtvs
Timeline for d6itqd1: