SCOPe 2.07: Domain d6iqsb_: 6iqs B:

Lineage for d6iqsb_ (6iqs B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (10 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein automated matches [190103] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [371847] (3 PDB entries)

8. Domain d6iqsb_: 6iqs B: [371880]
   automated match to d5wqlb_
   mutant

Details for d6iqsb_

PDB Entry: 6iqs, 2.69 Å

PDB Description: crystal structure of prc with l245a and l340g mutations in complex with nlpi

PDB Compounds: (B:) Lipoprotein nlpI

SCOPe Domain Sequences for d6iqsb_:

Sequence; same for both SEQRES and ATOM records:

>d6iqsb_ a.118.8.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
ksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralarndf
sqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyyggr
dklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwnivef
ylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklavannv
hnfvehryallelsllgqd

Timeline for d6iqsb_:

• d6iqsb_ is new in SCOPe 2.07-stable
  
• d6iqsb_ appears in the current release, SCOPe 2.08