SCOP 1.71: Domain d3rsp__: 3rsp -

Lineage for d3rsp__ (3rsp -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (125 PDB entries)

8. Domain d3rsp__: 3rsp - [37188]
   complexed with cl; mutant

Details for d3rsp__

PDB Entry: 3rsp, 1.7 Å

PDB Description: structure of the p93g variant of ribonuclease a

SCOP Domain Sequences for d3rsp__:

Sequence; same for both SEQRES and ATOM records:

>d3rsp__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskygncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d3rsp__:

• d3rsp__ first appeared (with stable ids) in SCOP 1.55
  
• d3rsp__ appears in SCOP 1.69
  
• d3rsp__ is called d3rspa_ in SCOP 1.73
  
• d3rsp__ appears in the current release, SCOPe 2.08, called d3rspa_