![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.17: Fungal lipases [53558] (5 proteins) |
![]() | Protein automated matches [190510] (9 species) not a true protein |
![]() | Species Pseudozyma antarctica [TaxId:84753] [371852] (8 PDB entries) |
![]() | Domain d6ispd1: 6isp D:1-316 [371862] Other proteins in same PDB: d6ispa2, d6ispb2, d6ispc2, d6ispd2 automated match to d5a6va_ complexed with ca, cpq; mutant |
PDB Entry: 6isp (more details), 1.88 Å
SCOPe Domain Sequences for d6ispd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ispd1 c.69.1.17 (D:1-316) automated matches {Pseudozyma antarctica [TaxId: 84753]} lpsgsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaqlg ytpcwispppfmlndtqvnteymvnaittlyagsgnnklpvltvsqgglvaqwgltffps irskvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivptt nlysatdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsa lrsttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlmpy arpfavgkrtcsgivt
Timeline for d6ispd1: