SCOPe 2.07: Domain d6isra_: 6isr A:

Lineage for d6isra_ (6isr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein automated matches [190510] (9 species)
   not a true protein

7. Species Pseudozyma antarctica [TaxId:84753] [371852] (8 PDB entries)

8. Domain d6isra_: 6isr A: [371858]
   automated match to d5a6va_
   complexed with ni, peg, pg4; mutant

Details for d6isra_

PDB Entry: 6isr, 2.6 Å

PDB Description: structure of lipase mutant with cys-his-asp catalytic triad

PDB Compounds: (A:) lipase b

SCOPe Domain Sequences for d6isra_:

Sequence; same for both SEQRES and ATOM records:

>d6isra_ c.69.1.17 (A:) automated matches {Pseudozyma antarctica [TaxId: 84753]}
gsdpafsqpksvldagltcqgaspssvskpillvpgtgttgpqsfdsnwiplsaqlgytp
cwispppfmlndtqvnteymvnaittlyagsgnnklpvltvcqgglvaqwgltffpsirs
kvdrlmafapdykgtvlagpldalagsapsvwqqttgsalttalrnaggltqivpttnly
satdeivqpqvsnspldssylfngknvqaqavcgplfvidhagsltsqfsyvvgrsalrs
ttgqarsadygitdcnplpandltpeqkvaaaallapyyaaivagpkqncepdlmpyarp
favgkrtcsgivtp

Timeline for d6isra_:

• d6isra_ is new in SCOPe 2.07-stable
  
• d6isra_ appears in the current release, SCOPe 2.08