SCOPe 2.07: Domain d6itpb1: 6itp B:6-126

Lineage for d6itpb1 (6itp B:6-126)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Camelus bactrianus [TaxId:9837] [371849] (5 PDB entries)

8. Domain d6itpb1: 6itp B:6-126 [371850]
   Other proteins in same PDB: d6itpa2, d6itpb2
   automated match to d4nbxb_
   complexed with hcy

Details for d6itpb1

PDB Entry: 6itp, 1.57 Å

PDB Description: crystal structure of cortisol complexed with its nanobody at ph 3.5

PDB Compounds: (B:) anti-cortisol camelid antibody

SCOPe Domain Sequences for d6itpb1:

Sequence, based on SEQRES records:

>d6itpb1 b.1.1.1 (B:6-126) automated matches {Camelus bactrianus [TaxId: 9837]}
esgggsvqaggslrlscvvsgntgstgywawfrqgpgteregvaatytagsgtsmtyyad
svkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtv
s

Sequence, based on observed residues (ATOM records):

>d6itpb1 b.1.1.1 (B:6-126) automated matches {Camelus bactrianus [TaxId: 9837]}
esgggsvqaggslrlscvvsgntgstgywawfrqgpteregvaatytagsgtsmtyyads
vkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtvs

Timeline for d6itpb1:

• d6itpb1 is new in SCOPe 2.07-stable
  
• d6itpb1 appears in the current release, SCOPe 2.08