Lineage for d6itpb1 (6itp B:6-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742186Species Camelus bactrianus [TaxId:9837] [371849] (6 PDB entries)
  8. 2742193Domain d6itpb1: 6itp B:6-126 [371850]
    Other proteins in same PDB: d6itpa2, d6itpb2
    automated match to d4nbxb_
    complexed with hcy

Details for d6itpb1

PDB Entry: 6itp (more details), 1.57 Å

PDB Description: crystal structure of cortisol complexed with its nanobody at ph 3.5
PDB Compounds: (B:) anti-cortisol camelid antibody

SCOPe Domain Sequences for d6itpb1:

Sequence, based on SEQRES records: (download)

>d6itpb1 b.1.1.1 (B:6-126) automated matches {Camelus bactrianus [TaxId: 9837]}
esgggsvqaggslrlscvvsgntgstgywawfrqgpgteregvaatytagsgtsmtyyad
svkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtv
s

Sequence, based on observed residues (ATOM records): (download)

>d6itpb1 b.1.1.1 (B:6-126) automated matches {Camelus bactrianus [TaxId: 9837]}
esgggsvqaggslrlscvvsgntgstgywawfrqgpteregvaatytagsgtsmtyyads
vkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtvs

SCOPe Domain Coordinates for d6itpb1:

Click to download the PDB-style file with coordinates for d6itpb1.
(The format of our PDB-style files is described here.)

Timeline for d6itpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6itpb2