![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Camelus bactrianus [TaxId:9837] [371849] (6 PDB entries) |
![]() | Domain d6itpb1: 6itp B:6-126 [371850] Other proteins in same PDB: d6itpa2, d6itpb2 automated match to d4nbxb_ complexed with hcy |
PDB Entry: 6itp (more details), 1.57 Å
SCOPe Domain Sequences for d6itpb1:
Sequence, based on SEQRES records: (download)
>d6itpb1 b.1.1.1 (B:6-126) automated matches {Camelus bactrianus [TaxId: 9837]} esgggsvqaggslrlscvvsgntgstgywawfrqgpgteregvaatytagsgtsmtyyad svkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtv s
>d6itpb1 b.1.1.1 (B:6-126) automated matches {Camelus bactrianus [TaxId: 9837]} esgggsvqaggslrlscvvsgntgstgywawfrqgpteregvaatytagsgtsmtyyads vkgrftisqdnakktlylqmnslkpedtgmyrcastrfagrwyrdseyrawgqgtqvtvs
Timeline for d6itpb1: