Lineage for d9rat__ (9rat -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77162Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 77163Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 77164Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 77208Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 77209Species Cow (Bos taurus) [TaxId:9913] [54079] (99 PDB entries)
  8. 77233Domain d9rat__: 9rat - [37185]

Details for d9rat__

PDB Entry: 9rat (more details), 1.5 Å

PDB Description: effects of temperature on protein structure and dynamics: x-ray crystallographic studies of the protein ribonuclease-a at nine different temperatures from 98 to 320 k

SCOP Domain Sequences for d9rat__:

Sequence; same for both SEQRES and ATOM records: (download)

>d9rat__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d9rat__:

Click to download the PDB-style file with coordinates for d9rat__.
(The format of our PDB-style files is described here.)

Timeline for d9rat__: