Lineage for d3rsd__ (3rsd -)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130218Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 130219Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 130220Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 130264Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 130265Species Cow (Bos taurus) [TaxId:9913] [54079] (110 PDB entries)
  8. 130297Domain d3rsd__: 3rsd - [37184]

Details for d3rsd__

PDB Entry: 3rsd (more details), 1.6 Å

PDB Description: structure of the d121n variant of ribonuclease a

SCOP Domain Sequences for d3rsd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rsd__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
nasv

SCOP Domain Coordinates for d3rsd__:

Click to download the PDB-style file with coordinates for d3rsd__.
(The format of our PDB-style files is described here.)

Timeline for d3rsd__: