![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.1: Ferrochelatase [53801] (2 proteins) automatically mapped to Pfam PF00762 |
![]() | Protein Ferrochelatase [53802] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [53803] (16 PDB entries) |
![]() | Domain d3goqa_: 3goq A: [371832] automated match to d2ac4a_ complexed with mg |
PDB Entry: 3goq (more details)
SCOPe Domain Sequences for d3goqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3goqa_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]} rkkmgllvmamgtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteq qahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsv qsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsa hslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdl feqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalat vvlkklg
Timeline for d3goqa_: