Lineage for d6cv4b_ (6cv4 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431879Species Enterovirus d68 [TaxId:42789] [269068] (15 PDB entries)
  8. 2431902Domain d6cv4b_: 6cv4 B: [371809]
    automated match to d4wm8c_

Details for d6cv4b_

PDB Entry: 6cv4 (more details), 3.03 Å

PDB Description: cryoem structure of human enterovirus d68 emptied particle (after incubation with low molecular weight heparin)
PDB Compounds: (B:) viral protein 3

SCOPe Domain Sequences for d6cv4b_:

Sequence, based on SEQRES records: (download)

>d6cv4b_ b.121.4.0 (B:) automated matches {Enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapvlpcfnptpemhipgqvrnmlevvqvesmmeinntes
avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmatgklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyrmfnn
dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqidhlh
aaeaay

Sequence, based on observed residues (ATOM records): (download)

>d6cv4b_ b.121.4.0 (B:) automated matches {Enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapvlpcfnptpemhipgqvrnmlevvqvesmmeinntes
avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmatgklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyranvg
yvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqhlhaaeaay

SCOPe Domain Coordinates for d6cv4b_:

Click to download the PDB-style file with coordinates for d6cv4b_.
(The format of our PDB-style files is described here.)

Timeline for d6cv4b_: