SCOPe 2.08: Domain d6cv1b_: 6cv1 B:

Lineage for d6cv1b_ (6cv1 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (51 species)
   not a true protein

7. Species Enterovirus d68 [TaxId:42789] [269068] (15 PDB entries)

8. Domain d6cv1b_: 6cv1 B: [371808]
   automated match to d4wm8c_

Details for d6cv1b_

PDB Entry: 6cv1, 2.76 Å

PDB Description: cryoem structure of human enterovirus d68 full particle (after incubation with heparin-derived hexasaccharide)

PDB Compounds: (B:) viral protein 3

SCOPe Domain Sequences for d6cv1b_:

Sequence; same for both SEQRES and ATOM records:

>d6cv1b_ b.121.4.0 (B:) automated matches {Enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapvlpcfnptpemhipgqvrnmlevvqvesmmeinntes
avgmerlkvdisaltdvdqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmatgklilcytppggscpttretamlgthivwdfglqssvtliipwisgshyrmfnn
dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqidhlh
aaeaayq

Timeline for d6cv1b_:

• d6cv1b_ first appeared in SCOPe 2.07