Lineage for d6aara_ (6aar A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Death-associated protein kinase, Dap [75560] (1 species)
    CaMK group; CAMKI subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [75561] (34 PDB entries)
    Uniprot P53355 2-285
  8. Domain d6aara_: 6aar A: [371798]
    automated match to d1jksa_
    complexed with 9tf

Details for d6aara_

PDB Entry: 6aar (more details), 1.95 Å

PDB Description: crystal structure of dapk1 in complex with purpurin
PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d6aara_:

Sequence, based on SEQRES records: (download)

>d6aara_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

Sequence, based on observed residues (ATOM records): (download)

>d6aara_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdlteeeateflkqilngvy
ylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpefvapei
vnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsntsala
kdfirrllvkdpkkrmtiqdslqhpwikp

SCOPe Domain Coordinates for d6aara_ are not available.

Timeline for d6aara_: