Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries) |
Domain d6s61v_: 6s61 V: [371796] automated match to d5up8a_ complexed with fe, zn |
PDB Entry: 6s61 (more details), 1.84 Å
SCOPe Domain Sequences for d6s61v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s61v_ a.25.1.1 (V:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} psqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheere haeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdk ndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg
Timeline for d6s61v_: