Lineage for d5zoia_ (5zoi A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518409Family c.87.1.11: FucT-like [159794] (2 proteins)
    Pfam PF00852; Glycosyltransferase family 10 (fucosyltransferase)
  6. 2518421Protein automated matches [371718] (1 species)
    not a true protein
  7. 2518422Species Helicobacter pylori [TaxId:210] [371719] (1 PDB entry)
  8. 2518423Domain d5zoia_: 5zoi A: [371792]
    automated match to d2nzya_
    complexed with c06

Details for d5zoia_

PDB Entry: 5zoi (more details), 3.19 Å

PDB Description: crystal structure of alpha1,3-fucosyltransferase
PDB Compounds: (A:) Alpha-(1,3)-fucosyltransferase FucT

SCOPe Domain Sequences for d5zoia_:

Sequence, based on SEQRES records: (download)

>d5zoia_ c.87.1.11 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknfvlyfilsqrytitlh
qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
rmplyynelhikaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
gfasfvasnpnapirnafndalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
knayldmlyenplntldgkayfyqnlsfkkilaffktildndtiyhdnpfif

Sequence, based on observed residues (ATOM records): (download)

>d5zoia_ c.87.1.11 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
mfqplldayvesasiekmasksppplkiavanwwgdeeikefknfvlyfilsqrytitlh
qnpnefsdlvfgnpyqnakrvfytgenespnfnlfdyaigfdeldfndrylrmplyynel
hikaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkrgfasfvasn
pnapirnafndalnsiepvtgggsvrntlgynvknkneflsqykfnlcfentqgygyvte
kiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhthknayldmly
enplntldgkayfyqnlsfkkilaffktildndtiyhdnpfif

SCOPe Domain Coordinates for d5zoia_:

Click to download the PDB-style file with coordinates for d5zoia_.
(The format of our PDB-style files is described here.)

Timeline for d5zoia_: