SCOPe 2.07: Domain d5zz0g_: 5zz0 G:

Lineage for d5zz0g_ (5zz0 G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.1: Gelsolin-like [55754] (5 proteins)

6. Protein Gelsolin [55759] (2 species)
   consists of six similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
   Uniprot P20065 55-179

8. Domain d5zz0g_: 5zz0 G: [371787]
   automated match to d5h3na_
   complexed with ca, pg0

Details for d5zz0g_

PDB Entry: 5zz0, 2.64 Å

PDB Description: human gelsolin from residues glu28 to arg161 with calcium

PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d5zz0g_:

Sequence; same for both SEQRES and ATOM records:

>d5zz0g_ d.109.1.1 (G:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
hpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydlhyw
lgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggvasg
fk

Timeline for d5zz0g_:

• d5zz0g_ is new in SCOPe 2.07-stable
  
• d5zz0g_ appears in the current release, SCOPe 2.08