Lineage for d5zuaa1 (5zua A:1-164)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. Family c.50.1.0: automated matches [191326] (1 protein)
    not a true family
  6. Protein automated matches [190146] (12 species)
    not a true protein
  7. Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [371715] (4 PDB entries)
  8. Domain d5zuaa1: 5zua A:1-164 [371780]
    Other proteins in same PDB: d5zuaa2
    automated match to d2fava_
    complexed with atp

Details for d5zuaa1

PDB Entry: 5zua (more details), 2.4699999999999998 Å

PDB Description: crystal structure of mers-cov macro domain in complex with atp
PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d5zuaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zuaa1 c.50.1.0 (A:1-164) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
plsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskgavq
kesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnayplv
vtplvsagifgvkpavsfdylireaktrvlvvvnsqdvykslti

SCOPe Domain Coordinates for d5zuaa1 are not available.

Timeline for d5zuaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zuaa2