Lineage for d1rnd__ (1rnd -)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188484Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 188485Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 188486Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 188538Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 188539Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)
  8. 188567Domain d1rnd__: 1rnd - [37178]

Details for d1rnd__

PDB Entry: 1rnd (more details), 1.5 Å

PDB Description: newly observed binding mode in pancreatic ribonuclease

SCOP Domain Sequences for d1rnd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rnd__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOP Domain Coordinates for d1rnd__:

Click to download the PDB-style file with coordinates for d1rnd__.
(The format of our PDB-style files is described here.)

Timeline for d1rnd__: