Lineage for d5zy9c2 (5zy9 C:294-400)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459598Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2459599Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2459718Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2459719Protein automated matches [227930] (6 species)
    not a true protein
  7. 3071651Species Phytophthora sojae [TaxId:67593] [371713] (1 PDB entry)
  8. 3071715Domain d5zy9c2: 5zy9 C:294-400 [371777]
    Other proteins in same PDB: d5zy9c1, d5zy9d1, d5zy9e1
    automated match to d4p3na2
    complexed with 2cr, zn

Details for d5zy9c2

PDB Entry: 5zy9 (more details), 2.5 Å

PDB Description: structural basis for a trna synthetase
PDB Compounds: (C:) Threonyl-tRNA synthase

SCOPe Domain Sequences for d5zy9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zy9c2 c.51.1.0 (C:294-400) automated matches {Phytophthora sojae [TaxId: 67593]}
fpfwlsprqvlivtvgaafvdygyevkdamfragfdvdiddtgktlnkkiregqmahynf
ilvvgaheketrsvnirtrdnkvtgtktleeaiamfkeleetkaade

SCOPe Domain Coordinates for d5zy9c2:

Click to download the PDB-style file with coordinates for d5zy9c2.
(The format of our PDB-style files is described here.)

Timeline for d5zy9c2:

  • d5zy9c2 is new in SCOPe 2.07-stable