SCOP 1.61: Domain d2rns__: 2rns -

Lineage for d2rns__ (2rns -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (115 PDB entries)

8. Domain d2rns__: 2rns - [37177]

Details for d2rns__

PDB Entry: 2rns, 1.6 Å

PDB Description: refinement of the crystal structure of ribonuclease s. comparison with and between the various ribonuclease a structures

SCOP Domain Sequences for d2rns__:

Sequence, based on SEQRES records:

>d2rns__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Sequence, based on observed residues (ATOM records):

>d2rns__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackng
qtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d2rns__:

• d2rns__ first appeared (with stable ids) in SCOP 1.55
  
• d2rns__ appears in SCOP 1.59
  
• d2rns__ appears in SCOP 1.63
  
• d2rns__ appears in the current release, SCOPe 2.08, called d2rnsa_