Lineage for d2rns__ (2rns -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 29802Fold d.5: RNase A-like [54075] (1 superfamily)
  4. 29803Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
  5. 29804Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 29839Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 29840Species Cow (Bos taurus) [TaxId:9913] [54079] (93 PDB entries)
  8. 29858Domain d2rns__: 2rns - [37177]

Details for d2rns__

PDB Entry: 2rns (more details), 1.6 Å

PDB Description: refinement of the crystal structure of ribonuclease s. comparison with and between the various ribonuclease a structures

SCOP Domain Sequences for d2rns__:

Sequence, based on SEQRES records: (download)

>d2rns__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Sequence, based on observed residues (ATOM records): (download)

>d2rns__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackng
qtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOP Domain Coordinates for d2rns__:

Click to download the PDB-style file with coordinates for d2rns__.
(The format of our PDB-style files is described here.)

Timeline for d2rns__: