Lineage for d6s61c_ (6s61 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702643Species Mouse (Mus musculus) [TaxId:10090] [355187] (7 PDB entries)
  8. 2702676Domain d6s61c_: 6s61 C: [371758]
    automated match to d5up8a_
    complexed with fe, zn

Details for d6s61c_

PDB Entry: 6s61 (more details), 1.84 Å

PDB Description: apoferritin from mouse at 1.84 angstrom resolution
PDB Compounds: (C:) ferritin heavy chain

SCOPe Domain Sequences for d6s61c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s61c_ a.25.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
psqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdk
ndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d6s61c_:

Click to download the PDB-style file with coordinates for d6s61c_.
(The format of our PDB-style files is described here.)

Timeline for d6s61c_: