SCOPe 2.08: Domain d5zuba1: 5zub A:1-164

Lineage for d5zuba1 (5zub A:1-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [371715] (4 PDB entries)

8. Domain d5zuba1: 5zub A:1-164 [371751]
   Other proteins in same PDB: d5zuba2
   automated match to d2fava_
   complexed with nad

Details for d5zuba1

PDB Entry: 5zub, 1.68 Å

PDB Description: crystal structure of mers-cov macro domain in complex with nad

PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d5zuba1:

Sequence; same for both SEQRES and ATOM records:

>d5zuba1 c.50.1.0 (A:1-164) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
plsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskgavq
kesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnayplv
vtplvsagifgvkpavsfdylireaktrvlvvvnsqdvykslti

Timeline for d5zuba1:

• d5zuba1 first appeared in SCOPe 2.07