SCOPe 2.08: Domain d5zolj1: 5zol J:1-220

Lineage for d5zolj1 (5zol J:1-220)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [277890] (11 PDB entries)

8. Domain d5zolj1: 5zol J:1-220 [371723]
   Other proteins in same PDB: d5zola2, d5zolb2, d5zolc2, d5zold2, d5zole2, d5zolf2, d5zolg2, d5zolh2, d5zoli2, d5zolj2
   automated match to d1l6wa_
   complexed with 4y8, cl, lw1, lw2, so4; mutant

Details for d5zolj1

PDB Entry: 5zol, 2.17 Å

PDB Description: crystal structure of a three sites mutantion of fsaa complexed with ha and product

PDB Compounds: (J:) Fructose-6-phosphate aldolase 1

SCOPe Domain Sequences for d5zolj1:

Sequence; same for both SEQRES and ATOM records:

>d5zolj1 c.1.10.1 (J:1-220) automated matches {Escherichia coli [TaxId: 83333]}
melyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfatv
mattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqglls
alagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcllag
cesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi

Timeline for d5zolj1:

• d5zolj1 first appeared in SCOPe 2.07