Lineage for d5zy9d1 (5zy9 D:1-293)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532556Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2532557Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2532945Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2532946Protein automated matches [226887] (24 species)
    not a true protein
  7. 3071649Species Phytophthora sojae [TaxId:67593] [371711] (1 PDB entry)
  8. 3071659Domain d5zy9d1: 5zy9 D:1-293 [371721]
    Other proteins in same PDB: d5zy9c2, d5zy9d2, d5zy9e2
    automated match to d4p3na1
    complexed with 2cr, zn

Details for d5zy9d1

PDB Entry: 5zy9 (more details), 2.5 Å

PDB Description: structural basis for a trna synthetase
PDB Compounds: (D:) Threonyl-tRNA synthase

SCOPe Domain Sequences for d5zy9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zy9d1 d.104.1.0 (D:1-293) automated matches {Phytophthora sojae [TaxId: 67593]}
mdhrrlgvseelfffhslspgsgfwlphgsaiyfkllkfireqyrargytevitpnifnm
elwnisghakhykenmfvfdvegqeyalkpmncpaaslmfdfrqrsyrelpiryadcgvl
hrnelsgaltgltrvrrfqqddahifcrddqikkevldflsfmkyvydvfgiefnlelst
rpekamgeleqweraesqlaealdefvgagkwvvnpgdgafygpkidimitdalkrqhqc
atvqldfqlpirfnlkyrtddadnfkrpviihraiygslerfvavlvehyagk

SCOPe Domain Coordinates for d5zy9d1:

Click to download the PDB-style file with coordinates for d5zy9d1.
(The format of our PDB-style files is described here.)

Timeline for d5zy9d1:

  • d5zy9d1 is new in SCOPe 2.07-stable