Lineage for d5zhbb_ (5zhb B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330024Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2330025Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2330252Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2330253Protein automated matches [190108] (21 species)
    not a true protein
  7. 3071636Species Bacillus thermoamylovorans [TaxId:35841] [371698] (1 PDB entry)
  8. 3071643Domain d5zhbb_: 5zhb B: [371705]
    automated match to d3wkga_
    complexed with edo

Details for d5zhbb_

PDB Entry: 5zhb (more details), 1.85 Å

PDB Description: structure of cellobiose 2-epimerase from bacillus thermoamylovorans b4167
PDB Compounds: (B:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d5zhbb_:

Sequence, based on SEQRES records: (download)

>d5zhbb_ a.102.1.0 (B:) automated matches {Bacillus thermoamylovorans [TaxId: 35841]}
mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqsnemlsengviad
itmnthlhvleaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesii
dlksyghdieaswliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengki
dytrvwwvqveamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadg
qptkreiagpwkcpyhnarfclefiervg

Sequence, based on observed residues (ATOM records): (download)

>d5zhbb_ a.102.1.0 (B:) automated matches {Bacillus thermoamylovorans [TaxId: 35841]}
mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqiaditmnthlhvl
eaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesiidlksyghdie
aswliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengkidytrvwwvqv
eamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadgqptkreiagp
wkcpyhnarfclefiervg

SCOPe Domain Coordinates for d5zhbb_:

Click to download the PDB-style file with coordinates for d5zhbb_.
(The format of our PDB-style files is described here.)

Timeline for d5zhbb_:

  • d5zhbb_ is new in SCOPe 2.07-stable