Class a: All alpha proteins [46456] (290 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
Protein automated matches [190621] (30 species) not a true protein |
Species Treponema denticola [TaxId:999437] [371624] (1 PDB entry) |
Domain d6s7jg_: 6s7j G: [371701] automated match to d1gkja_ |
PDB Entry: 6s7j (more details), 2.2 Å
SCOPe Domain Sequences for d6s7jg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6s7jg_ a.127.1.0 (G:) automated matches {Treponema denticola [TaxId: 999437]} daliltgkplsledvysvaynnrqvkisddaeervkkarqilfdmaaegkpvyglnrgvg wnkdkefdedffatynrnllnshclgvkpyhpdeqvrailllrlnkaltghtgisaellh hyrdflnygihpripmrssigegdittlshiglafigeedvsfngeimnskkamekaglk paklgpkdglsivscnaqgeamtaivlkeiedlvymsnlifclsleglngvvqslredvn avrgikgqikaaemcreflkgsflydpdperalqdplsfrcahsvngtmydamdyvreql lttmnttddnpciiidehssfvsanfeitslaigvemlatalshlsktscyrmikladps ftklnrfltpqdvktiafgtiqktftmldtqnrglanpssmdfyslagtiedhasnlpla cykifqmldniryiigieamhaaqaidlrgnkklgegtkkayslirevlpfynedrnisr dietmyefikskkllni
Timeline for d6s7jg_: