SCOP 1.59: Domain d5rat__: 5rat -

Lineage for d5rat__ (5rat -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (110 PDB entries)

8. Domain d5rat__: 5rat - [37170]

Details for d5rat__

PDB Entry: 5rat, 1.5 Å

PDB Description: Effects of temperature on protein structure and dynamics: X-ray crystallographic studies of the protein ribonuclease-A at nine different temperatures from 98 TO 320 K

SCOP Domain Sequences for d5rat__:

Sequence; same for both SEQRES and ATOM records:

>d5rat__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d5rat__:

• d5rat__ first appeared (with stable ids) in SCOP 1.55
  
• d5rat__ appears in SCOP 1.57
  
• d5rat__ appears in SCOP 1.61
  
• d5rat__ appears in the current release, SCOPe 2.08, called d5rata_