Lineage for d5zhba_ (5zhb A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. Protein automated matches [190108] (23 species)
    not a true protein
  7. Species Bacillus thermoamylovorans [TaxId:35841] [371698] (1 PDB entry)
  8. Domain d5zhba_: 5zhb A: [371699]
    automated match to d3wkga_
    complexed with edo

Details for d5zhba_

PDB Entry: 5zhb (more details), 1.85 Å

PDB Description: structure of cellobiose 2-epimerase from bacillus thermoamylovorans b4167
PDB Compounds: (A:) Cellobiose 2-epimerase

SCOPe Domain Sequences for d5zhba_:

Sequence, based on SEQRES records: (download)

>d5zhba_ a.102.1.0 (A:) automated matches {Bacillus thermoamylovorans [TaxId: 35841]}
mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqsnemlsengviad
itmnthlhvleaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesii
dlksyghdieaswliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengki
dytrvwwvqveamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadg
qptkreiagpwkcpyhnarfclefiervg

Sequence, based on observed residues (ATOM records): (download)

>d5zhba_ a.102.1.0 (A:) automated matches {Bacillus thermoamylovorans [TaxId: 35841]}
mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqsiaditmnthlhv
leaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesiidlksyghdi
easwliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengkidytrvwwvq
veamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadgqptkreiag
pwkcpyhnarfclefiervg

SCOPe Domain Coordinates for d5zhba_ are not available.

Timeline for d5zhba_:

Domains from other chains:
(mouse over for more information)
d5zhbb_