Lineage for d5zeeb1 (5zee B:1-295)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. Protein automated matches [190626] (14 species)
    not a true protein
  7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [371684] (3 PDB entries)
  8. Domain d5zeeb1: 5zee B:1-295 [371691]
    Other proteins in same PDB: d5zeeb2
    automated match to d2ceva_
    complexed with edo, har, mn

Details for d5zeeb1

PDB Entry: 5zee (more details), 1.7400000000000002 Å

PDB Description: crystal structure of entamoeba histolytica arginase in complex with n(omega)-hydroxy-l-arginine (noha) at 1.74 a
PDB Compounds: (B:) arginase

SCOPe Domain Sequences for d5zeeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zeeb1 c.42.1.0 (B:1-295) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mqfekvtyiavpqkygqkkvgveegpkfleklgfmnvleqvaksvnkktitepktpqelg
vtnarnlnevesvnielrdtiakeydvnnlliniggdhsiglgtiagvvkamkpnarvgv
vwfdahpdmntpenspsgnihgmplacavglgpqrltsimphyitpkdimyvgirsidvg
eqfeiqdkhidhftaedvkrvgmkevieainkkfvdydvihlsfdidgidpefilgtgtp
vpkgisledslyfmsemgkmkklhsvdiveynpkieeeitgknvlkcisslfgik

SCOPe Domain Coordinates for d5zeeb1 are not available.

Timeline for d5zeeb1:

Domains from same chain:
(mouse over for more information)
d5zeeb2
Domains from other chains:
(mouse over for more information)
d5zeea_