Lineage for d6rata_ (6rat A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890160Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 1890161Species Cow (Bos taurus) [TaxId:9913] [54079] (177 PDB entries)
  8. 1890179Domain d6rata_: 6rat A: [37167]

Details for d6rata_

PDB Entry: 6rat (more details), 1.5 Å

PDB Description: effects of temperature on protein structure and dynamics: x-ray crystallographic studies of the protein ribonuclease-a at nine different temperatures from 98 to 320 k
PDB Compounds: (A:) ribonuclease a

SCOPe Domain Sequences for d6rata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rata_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d6rata_:

Click to download the PDB-style file with coordinates for d6rata_.
(The format of our PDB-style files is described here.)

Timeline for d6rata_: