SCOP 1.57: Domain d6rat__: 6rat -

Lineage for d6rat__ (6rat -)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)

4. Superfamily d.5.1: RNase A-like [54076] (1 family)

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (99 PDB entries)

8. Domain d6rat__: 6rat - [37167]

Details for d6rat__

PDB Entry: 6rat, 1.5 Å

PDB Description: effects of temperature on protein structure and dynamics: x-ray crystallographic studies of the protein ribonuclease-a at nine different temperatures from 98 to 320 k

SCOP Domain Sequences for d6rat__:

Sequence; same for both SEQRES and ATOM records:

>d6rat__ d.5.1.1 (-) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus)}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d6rat__:

• d6rat__ first appeared (with stable ids) in SCOP 1.55
  
• d6rat__ appears in SCOP 1.59
  
• d6rat__ appears in the current release, SCOPe 2.08, called d6rata_