SCOPe 2.07: Domain d6s84f1: 6s84 F:1-103

Lineage for d6s84f1 (6s84 F:1-103)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [352469] (2 PDB entries)

8. Domain d6s84f1: 6s84 F:1-103 [371665]
   Other proteins in same PDB: d6s84c2, d6s84f2
   automated match to d2a6aa1
   protein/RNA complex; complexed with apc, leu, mg

Details for d6s84f1

PDB Entry: 6s84, 2.89 Å

PDB Description: tsabde complex from thermotoga maritima

PDB Compounds: (F:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d6s84f1:

Sequence; same for both SEQRES and ATOM records:

>d6s84f1 c.55.1.0 (F:1-103) automated matches {Thermotoga maritima [TaxId: 243274]}
mnvlaldtsqririglrkgedlfeisytgekkhaeilpvvvkklldeldlkvkdldvvgv
gigpggltglrvgiatvvglvspydipvaplnsfemtakscpa

Timeline for d6s84f1:

• d6s84f1 is new in SCOPe 2.07-stable
  
• d6s84f1 appears in the current release, SCOPe 2.08