| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries) |
| Domain d6rl0d2: 6rl0 D:508-638 [371660] Other proteins in same PDB: d6rl0a1, d6rl0b1, d6rl0c1, d6rl0d1 automated match to d3sbqa2 complexed with b3p, ca, cl, cua, cuk, fmt, k, na |
PDB Entry: 6rl0 (more details), 1.78 Å
SCOPe Domain Sequences for d6rl0d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rl0d2 b.6.1.0 (D:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa
Timeline for d6rl0d2: