Lineage for d6roga_ (6rog A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2417088Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2418094Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2418095Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2418104Protein automated matches [190126] (2 species)
    not a true protein
  7. 2418105Species Human (Homo sapiens) [TaxId:9606] [193097] (25 PDB entries)
  8. 2418128Domain d6roga_: 6rog A: [371651]
    automated match to d4in4c_
    complexed with fmt, na

Details for d6roga_

PDB Entry: 6rog (more details), 2.16 Å

PDB Description: crystal structure of the kelch domain of human keap1
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d6roga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6roga_ b.68.11.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgrliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnns
pdgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsvery
eperdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitam
ntirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhq
griyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d6roga_:

Click to download the PDB-style file with coordinates for d6roga_.
(The format of our PDB-style files is described here.)

Timeline for d6roga_: