Lineage for d6s4gb_ (6s4g B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896935Species Chromobacterium violaceum [TaxId:243365] [371613] (1 PDB entry)
  8. 2896937Domain d6s4gb_: 6s4g B: [371614]
    automated match to d4ah3a_
    complexed with edo, peg, pmp

Details for d6s4gb_

PDB Entry: 6s4g (more details), 1.67 Å

PDB Description: crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp
PDB Compounds: (B:) probable aminotransferase

SCOPe Domain Sequences for d6s4gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s4gb_ c.67.1.0 (B:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
ttsqwreldaahhlhpftdtaslnqagarvmtrgegvylwdsegnkiidgmaglwcvnvg
ygrkdfaeaarrqmeelpfyntffktthpavvelssllaevtpagfdrvfytnsgsesvd
tmirmvrrywdvqgkpekktligrwngyhgstiggaslggmkymheqgdlpipgmahieq
pwwykhgkdmtpdefgvvaarwleekileigadkvaafvgepiqgaggvivppatywpei
ericrkydvllvadevicgfgrtgewfghqhfgfqpdlftaakglssgylpigavfvgkr
vaegliaggdfnhgftysghpvcaavahanvaalrdegivqrvkddigpymqkrwretfs
rfehvddvrgvgmvqaftlvknkakrelfpdfgeigtlcrdiffrnnlimracgdhivsa
pplvmtraevdemlavaercleefeqtlkargl

SCOPe Domain Coordinates for d6s4gb_:

Click to download the PDB-style file with coordinates for d6s4gb_.
(The format of our PDB-style files is described here.)

Timeline for d6s4gb_: