Lineage for d6rwda2 (6rwd A:80-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712845Protein Class alpha GST [81349] (8 species)
  7. 2712988Species Schistosoma japonicum [TaxId:6182] [47633] (15 PDB entries)
    Uniprot P08515
  8. 2712989Domain d6rwda2: 6rwd A:80-216 [371607]
    Other proteins in same PDB: d6rwda1, d6rwdb1
    automated match to d1gtaa1
    complexed with cl, gsh, na, ref

Details for d6rwda2

PDB Entry: 6rwd (more details), 1.53 Å

PDB Description: crystal structure of sjgst in complex with gsh and ellagic acid at 1.53 angstrom resolution
PDB Compounds: (A:) Glutathione S-transferase class-mu 26 kDa isozyme

SCOPe Domain Sequences for d6rwda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rwda2 a.45.1.1 (A:80-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhpp

SCOPe Domain Coordinates for d6rwda2:

Click to download the PDB-style file with coordinates for d6rwda2.
(The format of our PDB-style files is described here.)

Timeline for d6rwda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6rwda1