Lineage for d1evwc_ (1evw C:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) 
Family d.4.1.3: Cys-His box [54069] (1 protein) Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species) Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (7 PDB entries) 
Domain d1evwc_: 1evw C: [37159]
Details for d1evwc_
PDB Entry: 1evw (more details), 3.1 Å
PDB Description: l116a mutant of the homing endonuclease i-ppoi complexed to homing site dna.
SCOP Domain Sequences for d1evwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evwc_ d.4.1.3 (C:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum)}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
SCOP Domain Coordinates for d1evwc_:
Click to download the PDB-style file with coordinates for d1evwc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1evwc_:
- d1evwc_ appears in SCOP 1.57
- d1evwc_ appears in the current release, SCOPe 2.08
View in 3D
