Lineage for d1evwb_ (1evw B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2927847Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2927848Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2927931Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)
  6. 2927935Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 2927936Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries)
  8. 2927952Domain d1evwb_: 1evw B: [37158]
    protein/DNA complex; complexed with mg, zn; mutant

Details for d1evwb_

PDB Entry: 1evw (more details), 3.1 Å

PDB Description: l116a mutant of the homing endonuclease i-ppoi complexed to homing site dna.
PDB Compounds: (B:) I-ppoi homing endonuclease

SCOPe Domain Sequences for d1evwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evwb_ d.4.1.3 (B:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOPe Domain Coordinates for d1evwb_:

Click to download the PDB-style file with coordinates for d1evwb_.
(The format of our PDB-style files is described here.)

Timeline for d1evwb_: