Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families) common motif contains conserved histidine residue and metal-binding site |
Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins) |
Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species) |
Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries) |
Domain d1evwb_: 1evw B: [37158] protein/DNA complex; complexed with mg, zn; mutant |
PDB Entry: 1evw (more details), 3.1 Å
SCOPe Domain Sequences for d1evwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evwb_ d.4.1.3 (B:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]} altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
Timeline for d1evwb_: