SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1evwa_ (1evw A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2155547Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 2155548Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 2155631Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 protein domains)
  6. 2155635Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 2155636Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries)
  8. 2155651Domain d1evwa_: 1evw A: [37157]
    protein/DNA complex; complexed with mg, zn; mutant

Details for d1evwa_

PDB Entry: 1evw (more details), 3.1 Å

PDB Description: l116a mutant of the homing endonuclease i-ppoi complexed to homing site dna.
PDB Compounds: (A:) I-ppoi homing endonuclease

SCOPe Domain Sequences for d1evwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evwa_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcwesaddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOPe Domain Coordinates for d1evwa_:

Click to download the PDB-style file with coordinates for d1evwa_.
(The format of our PDB-style files is described here.)

Timeline for d1evwa_: