Lineage for d1a74a_ (1a74 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1889894Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1889895Superfamily d.4.1: His-Me finger endonucleases [54060] (7 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1889978Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)
  6. 1889982Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 1889983Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries)
  8. 1889996Domain d1a74a_: 1a74 A: [37155]
    protein/DNA complex; complexed with zn

Details for d1a74a_

PDB Entry: 1a74 (more details), 2.2 Å

PDB Description: i-ppol homing endonuclease/dna complex
PDB Compounds: (A:) intron-encoded endonuclease I-ppoi

SCOPe Domain Sequences for d1a74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a74a_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOPe Domain Coordinates for d1a74a_:

Click to download the PDB-style file with coordinates for d1a74a_.
(The format of our PDB-style files is described here.)

Timeline for d1a74a_: