Lineage for d1a74a_ (1a74 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77113Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
  4. 77114Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
  5. 77134Family d.4.1.3: Cys-His box [54069] (1 protein)
  6. 77135Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 77136Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (7 PDB entries)
  8. 77145Domain d1a74a_: 1a74 A: [37155]

Details for d1a74a_

PDB Entry: 1a74 (more details), 2.2 Å

PDB Description: i-ppol homing endonuclease/dna complex

SCOP Domain Sequences for d1a74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a74a_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum)}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOP Domain Coordinates for d1a74a_:

Click to download the PDB-style file with coordinates for d1a74a_.
(The format of our PDB-style files is described here.)

Timeline for d1a74a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a74b_