Lineage for d6re4t2 (6re4 T:151-435)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872741Species Polytomella sp. [TaxId:37502] [371490] (10 PDB entries)
  8. 2872746Domain d6re4t2: 6re4 T:151-435 [371547]
    Other proteins in same PDB: d6re4s_, d6re4t1, d6re4t3
    automated match to d5cdfa2
    complexed with adp, atp, mg

Details for d6re4t2

PDB Entry: 6re4 (more details), 3 Å

PDB Description: cryo-em structure of polytomella f-atp synthase, rotary substate 2b, focussed refinement of f1 head and rotor
PDB Compounds: (T:) ATP synthase subunit alpha

SCOPe Domain Sequences for d6re4t2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6re4t2 c.37.1.0 (T:151-435) automated matches {Polytomella sp. [TaxId: 37502]}
vnvpigpgtlgrvtdglgqpidgkgpltnvrsslvevkapgiiarqsvreplftgvkavd
alvpigrgqreliigdrqtgktavaidaiihqkncneqvpkaqrvycvyvavgqkrstva
qlvklftqtgamrytimvsatasdaaplqflapysgcamaeyfrdtgkhgliiyddlskq
svayrqmslllrrppgreafpgdvfylhsrlleraaklskelgggsltafpvietqagdv
sayiatnvisitdgqifletelfykgirpalnvglsvsrvgsaaq

SCOPe Domain Coordinates for d6re4t2:

Click to download the PDB-style file with coordinates for d6re4t2.
(The format of our PDB-style files is described here.)

Timeline for d6re4t2:

View in 3D
Domains from other chains:
(mouse over for more information)
d6re4s_