| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures |
Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) ![]() common motif contains conserved histidine residue and metal-binding site |
| Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins) |
| Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species) |
| Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries) |
| Domain d1ippb_: 1ipp B: [37154] protein/DNA complex; complexed with cd, mg |
PDB Entry: 1ipp (more details), 2.2 Å
SCOPe Domain Sequences for d1ippb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ippb_ d.4.1.3 (B:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
Timeline for d1ippb_: