Lineage for d1ippa_ (1ipp A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) 
Family d.4.1.3: Cys-His box [54069] (1 protein) Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species) Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (7 PDB entries) 
Domain d1ippa_: 1ipp A: [37153]
Details for d1ippa_
PDB Entry: 1ipp (more details), 2.2 Å
PDB Description: homing endonuclease/dna complex
SCOP Domain Sequences for d1ippa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ippa_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum)}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
SCOP Domain Coordinates for d1ippa_:
Click to download the PDB-style file with coordinates for d1ippa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ippa_:
- d1ippa_ appears in SCOP 1.57
- d1ippa_ appears in the current release, SCOPe 2.08
View in 3D
