| Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
| Fold d.4: His-Me finger endonucleases [54059] (1 superfamily) |
Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) ![]() |
| Family d.4.1.3: Cys-His box [54069] (1 protein) |
| Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species) |
| Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (7 PDB entries) |
| Domain d1cz0a_: 1cz0 A: [37151] |
PDB Entry: 1cz0 (more details), 2.1 Å
SCOP Domain Sequences for d1cz0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cz0a_ d.4.1.3 (A:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum)}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctashlchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv
Timeline for d1cz0a_: