Lineage for d6r4kb_ (6r4k B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) Protein Beta-glucosidase A [51528] (10 species) 
Species Bacillus polymyxa [TaxId:1406] [51529] (7 PDB entries) 
Domain d6r4kb_: 6r4k B: [371486]
automated match to d1e4ia_
complexed with jsk
Details for d6r4kb_
PDB Entry: 6r4k (more details), 2.13 Å
PDB Description: structure of beta-glucosidase a from paenibacillus polymyxa complexed with a monovalent inhibitor
PDB Compounds: (B:) beta-glucosidase aSCOPe Domain Sequences for d6r4kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r4kb_ c.1.8.4 (B:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]}
mtifqfpqdfmwgtataayqiegayqedgrglsiwdtfahtpgkvfngdngnvacdsyhr
yeedirlmkelgirtyrfsvswprifpngdgevnqkgldyyhrvvdllndngiepfctly
hwdlpqalqdaggwgnrrtiqafvqfaetmfrefhgkiqhwltfnepwciaflsnmlgvh
apgltnlqtaidvghhllvahglsvrrfrelgtsgqigiapnvswavpystseedkaaca
rtislhsdwflqpiyqgsypqflvdwfaeqgatvpiqdgdmdiigepidmiginyysmsv
nrfnpeagflqseeinmglpvtdigwpvesrglyevlhylqkygnidiyitengacinde
vvngkvqddrrisymqqhlvqvhraihdglhvkgymawslldnfewaegysmrfgiihvd
frtqvrtpkesyywyrkvvgnnwletrr
SCOPe Domain Coordinates for d6r4kb_:
Click to download the PDB-style file with coordinates for d6r4kb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6r4kb_:
- d6r4kb_ first appeared in SCOPe 2.07
View in 3D
