Lineage for d1cyqb_ (1cyq B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192553Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
    core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures
  4. 1192554Superfamily d.4.1: His-Me finger endonucleases [54060] (6 families) (S)
    common motif contains conserved histidine residue and metal-binding site
  5. 1192632Family d.4.1.3: Intron-encoded homing endonucleases [54069] (2 proteins)
  6. 1192636Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 1192637Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (8 PDB entries)
  8. 1192641Domain d1cyqb_: 1cyq B: [37148]
    protein/DNA complex; complexed with mg, zn

Details for d1cyqb_

PDB Entry: 1cyq (more details), 1.93 Å

PDB Description: intron encoded homing endonuclease i-ppoi (h98a)/dna homing site complex
PDB Compounds: (B:) intron-encoded homing endonuclease I-ppoi

SCOPe Domain Sequences for d1cyqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyqb_ d.4.1.3 (B:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum) [TaxId: 5791]}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOPe Domain Coordinates for d1cyqb_:

Click to download the PDB-style file with coordinates for d1cyqb_.
(The format of our PDB-style files is described here.)

Timeline for d1cyqb_: