Lineage for d1cyqb_ (1cyq B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77113Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
  4. 77114Superfamily d.4.1: His-Me finger endonucleases [54060] (4 families) (S)
  5. 77134Family d.4.1.3: Cys-His box [54069] (1 protein)
  6. 77135Protein Intron-encoded homing endonuclease I-PpoI [54070] (1 species)
  7. 77136Species Slime mold (Physarum polycephalum) [TaxId:5791] [54071] (7 PDB entries)
  8. 77140Domain d1cyqb_: 1cyq B: [37148]

Details for d1cyqb_

PDB Entry: 1cyq (more details), 1.93 Å

PDB Description: intron encoded homing endonuclease i-ppoi (h98a)/dna homing site complex

SCOP Domain Sequences for d1cyqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cyqb_ d.4.1.3 (B:) Intron-encoded homing endonuclease I-PpoI {Slime mold (Physarum polycephalum)}
altnaqilavidsweetvgqfpvithhvplggglqgtlhcyeiplaapygvgfakngptr
wqykrtinqvvhrwgshtvpfllepdningktctasalchntrchnplhlcweslddnkg
rnwcpgpnggcvhavvclrqgplygpgatvagpqqrgshfvv

SCOP Domain Coordinates for d1cyqb_:

Click to download the PDB-style file with coordinates for d1cyqb_.
(The format of our PDB-style files is described here.)

Timeline for d1cyqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cyqa_